PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001243.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 378aa    MW: 43720.8 Da    PI: 7.6679
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001243.1_g00005.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR165.91e-2059146291
                     FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnH 87 
                               Yn+YA++vGFs+rk k++++  ++++ ++tf Csk g +++e++    +  ++   rt C a ++   + +g+w vtk e+ HnH
  Itr_sc001243.1_g00005.1  59 LYNDYAYRVGFSLRKGKQRYQGSTNNVEMKTFLCSKAGCKSKENSG--VKAYSKIDLRTWCGAFVQFDVDGNGVWTVTKHEKAHNH 142
                              7********************99******************99888..8889999******************************* PP

                     FAR1  88 elap 91 
                              el++
  Itr_sc001243.1_g00005.1 143 ELCT 146
                              **95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.7E-1759145IPR004330FAR1 DNA binding domain
PfamPF105513.0E-20268351IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MQISWLSQQN IQIVNVEFYD FECVIEFCFG ILNLMEISFL FDQDLVGIVV SNGDEASELY  60
NDYAYRVGFS LRKGKQRYQG STNNVEMKTF LCSKAGCKSK ENSGVKAYSK IDLRTWCGAF  120
VQFDVDGNGV WTVTKHEKAH NHELCTLDKS HLLRSHRRVG NNQHSYLRFL NKSGVALADR  180
IRFLKHQLGG SPLVGFTNRD VYDSLASDSL KSLDGTYSNS LIEIFRMRQC NESDFFFDFE  240
VDGDARLTII FWRDGQMRRD YELFGDLLVH DTTYRTNTYN MICGPFIGMN HHCMNERIES  300
FVWLFRAFLR SMGGKCPQTI MIDQCAAMAA AISQVFTTSR HRLCIWHIGE NSKKHIKTLR  360
NNKDFMDLFN CLLKYTDT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010673996.11e-111PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14143211
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.17e-45FAR1-related sequence 5